PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_42214_a_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family M-type_MADS
Protein Properties Length: 65aa    MW: 7545.86 Da    PI: 10.938
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_42214_a_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF104.14.7e-33959151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    krienk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+iifs++gklye++s
  Neem_42214_a_1  9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS 59
                    79***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.557161IPR002100Transcription factor, MADS-box
SMARTSM004321.3E-41160IPR002100Transcription factor, MADS-box
CDDcd002653.65E-38264No hitNo description
SuperFamilySSF554552.75E-31263IPR002100Transcription factor, MADS-box
PRINTSPR004046.9E-34323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.1E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004046.9E-342338IPR002100Transcription factor, MADS-box
PRINTSPR004046.9E-343859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 65 aa     Download sequence    Send to blast
MGRGRVELKR IENKINRQVT FAKRRNGLLK KAYELSVLCD AEVALIIFSN RGKLYEFCST  60
NRKQA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P8e-21161161Myocyte-specific enhancer factor 2B
1tqe_Q8e-21161161Myocyte-specific enhancer factor 2B
1tqe_R8e-21161161Myocyte-specific enhancer factor 2B
1tqe_S8e-21161161Myocyte-specific enhancer factor 2B
3mu6_A8e-21261160Myocyte-specific enhancer factor 2A
3mu6_B8e-21261160Myocyte-specific enhancer factor 2A
3mu6_C8e-21261160Myocyte-specific enhancer factor 2A
3mu6_D8e-21261160Myocyte-specific enhancer factor 2A
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY9474649e-59AY947464.1 Prunus dulcis MADS-box transcription factor (MADS3) mRNA, complete cds.
GenBankEF4403529e-59EF440352.1 Prunus persica transcription factor MADS7 (MADS7) mRNA, complete cds.
GenBankJQ6867259e-59JQ686725.1 Prunus avium transcription factor MADS4 (MADS4) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006385889.11e-37hypothetical protein POPTR_0003s16800g
SwissprotP0C5B01e-37MADS7_ORYSI; MADS-box transcription factor 7
SwissprotQ0J4661e-37MADS7_ORYSJ; MADS-box transcription factor 7
TrEMBLA0A103XKV52e-37A0A103XKV5_CYNCS; Transcription factor, K-box
TrEMBLU5GMT91e-37U5GMT9_POPTR; Uncharacterized protein
STRINGPOPTR_0003s16800.13e-37(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7828413
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G24260.31e-38MIKC_MADS family protein